PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g37047.1.p
Common NameBRADI_3g37047, LOC100836788
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 304aa    MW: 32261.2 Da    PI: 8.3251
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g37047.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94.2e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd+ lv +++++G+g+W++++   g+ R+ k+c++rw +yl
  Bradi3g37047.1.p 14 KGPWTPEEDLMLVSYIQEHGPGNWRAVPTNTGLMRCSKSCRLRWTNYL 61
                      79********************************************97 PP

2Myb_DNA-binding51.42.5e-1667112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++T +E++l+v++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Bradi3g37047.1.p  67 RGNFTDQEEKLIVHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
                       89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.948961IPR017930Myb domain
SuperFamilySSF466894.87E-3011108IPR009057Homeodomain-like
SMARTSM007171.3E-131363IPR001005SANT/Myb domain
PfamPF002494.5E-161461IPR001005SANT/Myb domain
CDDcd001671.57E-111661No hitNo description
PROSITE profilePS5129424.90362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-2465117IPR009057Homeodomain-like
SMARTSM007173.2E-1666114IPR001005SANT/Myb domain
PfamPF002494.9E-1567112IPR001005SANT/Myb domain
CDDcd001671.42E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0010468Biological Processregulation of gene expression
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MGRPPCCDQA GVKKGPWTPE EDLMLVSYIQ EHGPGNWRAV PTNTGLMRCS KSCRLRWTNY  60
LRPGIKRGNF TDQEEKLIVH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKRKLKKMS  120
AAAGEDGAAA ATAGGAEAKS RATAPKGQWE RRLQTDIHTA RQALRDALSL DTTAPAPPKP  180
APMERSSKGA VYASSAENIA RLLEGWMRPG EGKASSGGSG SGSRSSASVV SAEGASASHS  240
GTAPTPEGST VTSKTKDEVA VAAPPAFSML ENWLFDDGMG MGHNGIGDVG LDDVPLGDPS  300
EFF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A8e-27141164105MYB PROTO-ONCOGENE PROTEIN
1h8a_C2e-261211625128MYB TRANSFORMING PROTEIN
1mse_C9e-27141164105C-Myb DNA-Binding Domain
1msf_C9e-27141164105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00579DAPTransfer from AT5G62470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8377780.0CT837778.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA023K22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003574549.10.0PREDICTED: transcription factor MYB30-like
SwissprotP813921e-105MYB06_ANTMA; Myb-related protein 306
TrEMBLI1I7G10.0I1I7G1_BRADI; Uncharacterized protein
STRINGBRADI3G37047.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.16e-97myb domain protein 94